Lineage for d1hr0m_ (1hr0 M:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 95624Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
  4. 95675Superfamily a.5.5: Ribosomal protein S13 [46946] (1 family) (S)
  5. 95676Family a.5.5.1: Ribosomal protein S13 [46947] (1 protein)
  6. 95677Protein Ribosomal protein S13 [46948] (1 species)
  7. 95678Species Thermus thermophilus [TaxId:274] [46949] (10 PDB entries)
  8. 95680Domain d1hr0m_: 1hr0 M: [16294]
    Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_

Details for d1hr0m_

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

SCOP Domain Sequences for d1hr0m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0m_ a.5.5.1 (M:) Ribosomal protein S13 {Thermus thermophilus}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

SCOP Domain Coordinates for d1hr0m_:

Click to download the PDB-style file with coordinates for d1hr0m_.
(The format of our PDB-style files is described here.)

Timeline for d1hr0m_: