SCOPe 2.06: Domain d2awxb_: 2awx B:

Lineage for d2awxb_ (2awx B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (7 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186775] (11 PDB entries)

8. Domain d2awxb_: 2awx B: [162936]
   automated match to d1qlca_
   complexed with his

Details for d2awxb_

PDB Entry: 2awx, 1.8 Å

PDB Description: synapse associated protein 97 pdz2 domain variant c378s

PDB Compounds: (B:) Synapse associated protein 97

SCOPe Domain Sequences for d2awxb_:

Sequence; same for both SEQRES and ATOM records:

>d2awxb_ b.36.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
imeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdkllavns
vsleevtheeavtalkntsdfvylkvakp

Timeline for d2awxb_:

• d2awxb_ first appeared in SCOPe 2.01
  
• d2awxb_ appears in SCOPe 2.05
  
• d2awxb_ appears in SCOPe 2.07
  
• d2awxb_ appears in the current release, SCOPe 2.08