Lineage for d2awwb_ (2aww B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2056344Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2056345Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2056346Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2056646Protein automated matches [190055] (7 species)
    not a true protein
  7. 2056746Species Norway rat (Rattus norvegicus) [TaxId:10116] [186775] (11 PDB entries)
  8. 2056763Domain d2awwb_: 2aww B: [162934]
    automated match to d1qlca_

Details for d2awwb_

PDB Entry: 2aww (more details), 2.21 Å

PDB Description: synapse associated protein 97 pdz2 domain variant c378g with c- terminal glur-a peptide
PDB Compounds: (B:) Synapse associated protein 97

SCOPe Domain Sequences for d2awwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2awwb_ b.36.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ekimeiklikgpkglgfsiaggvgnqhipgdnsiyvtsiveggaahkdgklqigdkllav
nsvgleevtheeavtalkntsdfvylkvakp

SCOPe Domain Coordinates for d2awwb_:

Click to download the PDB-style file with coordinates for d2awwb_.
(The format of our PDB-style files is described here.)

Timeline for d2awwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2awwa_