SCOPe 2.08: Domain d2awwb_: 2aww B:

Lineage for d2awwb_ (2aww B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186775] (10 PDB entries)

8. Domain d2awwb_: 2aww B: [162934]
   automated match to d1qlca_

Details for d2awwb_

PDB Entry: 2aww, 2.21 Å

PDB Description: synapse associated protein 97 pdz2 domain variant c378g with c- terminal glur-a peptide

PDB Compounds: (B:) Synapse associated protein 97

SCOPe Domain Sequences for d2awwb_:

Sequence; same for both SEQRES and ATOM records:

>d2awwb_ b.36.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ekimeiklikgpkglgfsiaggvgnqhipgdnsiyvtsiveggaahkdgklqigdkllav
nsvgleevtheeavtalkntsdfvylkvakp

Timeline for d2awwb_:

• d2awwb_ first appeared in SCOPe 2.01
  
• d2awwb_ appears in SCOPe 2.07