Lineage for d1fjgm_ (1fjg M:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 218644Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 218645Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 218646Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
  6. 218647Protein Ribosomal protein S13 [46948] (1 species)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
  7. 218648Species Thermus thermophilus [TaxId:274] [46949] (14 PDB entries)
  8. 218649Domain d1fjgm_: 1fjg M: [16293]
    Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_
    complexed with mg, par, scm, sry, zn

Details for d1fjgm_

PDB Entry: 1fjg (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjgm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjgm_ a.156.1.1 (M:) Ribosomal protein S13 {Thermus thermophilus}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

SCOP Domain Coordinates for d1fjgm_:

Click to download the PDB-style file with coordinates for d1fjgm_.
(The format of our PDB-style files is described here.)

Timeline for d1fjgm_: