Lineage for d1fjgm_ (1fjg M:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1765Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
  4. 1802Superfamily a.5.5: Ribosomal protein S13 [46946] (1 family) (S)
  5. 1803Family a.5.5.1: Ribosomal protein S13 [46947] (1 protein)
  6. 1804Protein Ribosomal protein S13 [46948] (1 species)
  7. 1805Species Thermus thermophilus [TaxId:274] [46949] (6 PDB entries)
  8. 1807Domain d1fjgm_: 1fjg M: [16293]
    Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_

Details for d1fjgm_

PDB Entry: 1fjg (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjgm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjgm_ a.5.5.1 (M:) Ribosomal protein S13 {Thermus thermophilus}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

SCOP Domain Coordinates for d1fjgm_:

Click to download the PDB-style file with coordinates for d1fjgm_.
(The format of our PDB-style files is described here.)

Timeline for d1fjgm_: