SCOPe 2.01: Domain d2awja_: 2awj A:

Lineage for d2awja_ (2awj A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (4 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (118 PDB entries)
   Uniprot P42212

8. Domain d2awja_: 2awj A: [162927]
   automated match to d1qy3a_
   complexed with mg

Details for d2awja_

PDB Entry: 2awj, 1.6 Å

PDB Description: gfp r96m pre-cyclized intermediate in chromophore formation

PDB Compounds: (A:) green-fluorescent protein

SCOPe Domain Sequences for d2awja_:

Sequence; same for both SEQRES and ATOM records:

>d2awja_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
tltygvqcfsrypdhmkqhdffksampegyvqemtisfkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

Timeline for d2awja_:

• d2awja_ is new in SCOPe 2.01-stable
  
• d2awja_ appears in SCOPe 2.02
  
• d2awja_ appears in the current release, SCOPe 2.08