Lineage for d2avqb_ (2avq B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1548217Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1548218Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1548219Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1548235Protein Human immunodeficiency virus type 1 protease [50632] (8 species)
  7. Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (42 PDB entries)
  8. 1548284Domain d2avqb_: 2avq B: [162920]
    automated match to d1fgcc_
    complexed with 2nc, dms, gol; mutant

Details for d2avqb_

PDB Entry: 2avq (more details), 1.3 Å

PDB Description: kinetics, stability, and structural changes in high resolution crystal structures of hiv-1 protease with drug resistant mutations l24i, i50v, and g73s
PDB Compounds: (B:) Pol polyprotein

SCOPe Domain Sequences for d2avqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avqb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggvggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOPe Domain Coordinates for d2avqb_:

Click to download the PDB-style file with coordinates for d2avqb_.
(The format of our PDB-style files is described here.)

Timeline for d2avqb_: