Lineage for d2av4a1 (2av4 A:22-154)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1369326Family c.47.1.8: spliceosomal protein U5-15Kd [52895] (2 proteins)
    automatically mapped to Pfam PF02966
  6. 1369334Protein automated matches [190487] (1 species)
    not a true protein
  7. 1369335Species Plasmodium yoelii [TaxId:5861] [187429] (1 PDB entry)
  8. 1369336Domain d2av4a1: 2av4 A:22-154 [162914]
    automated match to d1qgva_
    complexed with cl

Details for d2av4a1

PDB Entry: 2av4 (more details), 1.73 Å

PDB Description: crystal structure of plasmodium yoelii thioredoxin-like protein 4a (dim1)
PDB Compounds: (A:) Thioredoxin-like protein 4A (DIM1)

SCOPe Domain Sequences for d2av4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2av4a1 c.47.1.8 (A:22-154) automated matches {Plasmodium yoelii [TaxId: 5861]}
mlqhlnsgwavdqaivnederlvcirfghdydpdcmkmdellykvaddiknfcviylvdi
tevpdfntmyelydpvsvmffyrnkhmmidlgtgnnnkinwpmnnkqefidivetifrga
rkgrglvispkdy

SCOPe Domain Coordinates for d2av4a1:

Click to download the PDB-style file with coordinates for d2av4a1.
(The format of our PDB-style files is described here.)

Timeline for d2av4a1: