| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.8: spliceosomal protein U5-15Kd [52895] (2 proteins) automatically mapped to Pfam PF02966 |
| Protein automated matches [190487] (2 species) not a true protein |
| Species Plasmodium yoelii [TaxId:5861] [187429] (1 PDB entry) |
| Domain d2av4a1: 2av4 A:22-154 [162914] Other proteins in same PDB: d2av4a2 automated match to d1qgva_ complexed with cl |
PDB Entry: 2av4 (more details), 1.73 Å
SCOPe Domain Sequences for d2av4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2av4a1 c.47.1.8 (A:22-154) automated matches {Plasmodium yoelii [TaxId: 5861]}
mlqhlnsgwavdqaivnederlvcirfghdydpdcmkmdellykvaddiknfcviylvdi
tevpdfntmyelydpvsvmffyrnkhmmidlgtgnnnkinwpmnnkqefidivetifrga
rkgrglvispkdy
Timeline for d2av4a1: