Lineage for d2autd_ (2aut D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527298Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
    the insertion subdomain is a helical hairpin
    automatically mapped to Pfam PF03767
  6. 2527299Protein Class B acid phosphatase, AphA [102308] (2 species)
  7. 2527327Species Salmonella typhimurium [TaxId:90371] [142153] (4 PDB entries)
    Uniprot P58683 30-237
  8. 2527339Domain d2autd_: 2aut D: [162913]
    automated match to d1z5ga1
    complexed with mg, na, po4; mutant

Details for d2autd_

PDB Entry: 2aut (more details), 2.25 Å

PDB Description: crystal structure of lys154asn mutant of mature apha of s. typhimurium
PDB Compounds: (D:) AphA

SCOPe Domain Sequences for d2autd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2autd_ c.108.1.12 (D:) Class B acid phosphatase, AphA {Salmonella typhimurium [TaxId: 90371]}
pstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkkt
yspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetv
sktladnfhipaanmnpvifagdkpeqntnvqwlqeknmrifygdsdnditaardcgirg
irilraanstykplpqagafgeevivnsey

SCOPe Domain Coordinates for d2autd_:

Click to download the PDB-style file with coordinates for d2autd_.
(The format of our PDB-style files is described here.)

Timeline for d2autd_: