Lineage for d2autc_ (2aut C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527298Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
    the insertion subdomain is a helical hairpin
    automatically mapped to Pfam PF03767
  6. 2527299Protein Class B acid phosphatase, AphA [102308] (2 species)
  7. 2527327Species Salmonella typhimurium [TaxId:90371] [142153] (4 PDB entries)
    Uniprot P58683 30-237
  8. 2527338Domain d2autc_: 2aut C: [162912]
    automated match to d1z5ga1
    complexed with mg, na, po4; mutant

Details for d2autc_

PDB Entry: 2aut (more details), 2.25 Å

PDB Description: crystal structure of lys154asn mutant of mature apha of s. typhimurium
PDB Compounds: (C:) AphA

SCOPe Domain Sequences for d2autc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2autc_ c.108.1.12 (C:) Class B acid phosphatase, AphA {Salmonella typhimurium [TaxId: 90371]}
stlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkkty
spdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetvs
ktladnfhipaanmnpvifagdkpeqntnvqwlqeknmrifygdsdnditaardcgirgi
rilraanstykplpqagafgeevivnsey

SCOPe Domain Coordinates for d2autc_:

Click to download the PDB-style file with coordinates for d2autc_.
(The format of our PDB-style files is described here.)

Timeline for d2autc_: