Lineage for d2aurb_ (2aur B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903555Protein automated matches [190359] (30 species)
    not a true protein
  7. 903559Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (30 PDB entries)
  8. 903617Domain d2aurb_: 2aur B: [162907]
    automated match to d2av0a1
    complexed with hem

Details for d2aurb_

PDB Entry: 2aur (more details), 2.3 Å

PDB Description: f97v (no ligand bound)
PDB Compounds: (B:) Globin I

SCOPe Domain Sequences for d2aurb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aurb_ a.1.1.2 (B:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekvavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d2aurb_:

Click to download the PDB-style file with coordinates for d2aurb_.
(The format of our PDB-style files is described here.)

Timeline for d2aurb_: