SCOPe 2.08: Domain d2aurb_: 2aur B:

Lineage for d2aurb_ (2aur B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (43 species)
   not a true protein

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (32 PDB entries)

8. Domain d2aurb_: 2aur B: [162907]
   automated match to d2av0a1
   complexed with hem

Details for d2aurb_

PDB Entry: 2aur, 2.3 Å

PDB Description: f97v (no ligand bound)

PDB Compounds: (B:) Globin I

SCOPe Domain Sequences for d2aurb_:

Sequence; same for both SEQRES and ATOM records:

>d2aurb_ a.1.1.2 (B:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekvavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d2aurb_:

• d2aurb_ first appeared in SCOPe 2.01
  
• d2aurb_ appears in SCOPe 2.07