Lineage for d2aupb_ (2aup B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903555Protein automated matches [190359] (30 species)
    not a true protein
  7. 903559Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (30 PDB entries)
  8. 903587Domain d2aupb_: 2aup B: [162903]
    automated match to d1nxfa_
    complexed with hem

Details for d2aupb_

PDB Entry: 2aup (more details), 1.8 Å

PDB Description: residue f4 plays a key role in modulating oxygen affinity and cooperativity in scapharca dimeric hemoglobin
PDB Compounds: (B:) Globin I

SCOPe Domain Sequences for d2aupb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aupb_ a.1.1.2 (B:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekyavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d2aupb_:

Click to download the PDB-style file with coordinates for d2aupb_.
(The format of our PDB-style files is described here.)

Timeline for d2aupb_: