Class a: All alpha proteins [46456] (289 folds) |
Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) |
Family a.5.3.1: CRAL/TRIO N-terminal domain [46939] (3 proteins) |
Protein N-terminal domain of phosphatidylinositol transfer protein sec14p [46940] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46941] (1 PDB entry) |
Domain d1auaa1: 1aua A:4-96 [16290] Other proteins in same PDB: d1auaa2 complexed with bog |
PDB Entry: 1aua (more details), 2.5 Å
SCOPe Domain Sequences for d1auaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1auaa1 a.5.3.1 (A:4-96) N-terminal domain of phosphatidylinositol transfer protein sec14p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} qqekeflesypqncppdalpgtpgnldsaqekalaelrklledagfierlddstllrflr arkfdvqlakemfencekwrkdygtdtilqdfh
Timeline for d1auaa1: