Lineage for d1aua_1 (1aua 4-96)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 150591Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
  4. 150633Superfamily a.5.3: N-terminal domain of phosphatidylinositol transfer protein sec14p [46938] (1 family) (S)
  5. 150634Family a.5.3.1: N-terminal domain of phosphatidylinositol transfer protein sec14p [46939] (1 protein)
  6. 150635Protein N-terminal domain of phosphatidylinositol transfer protein sec14p [46940] (1 species)
  7. 150636Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46941] (1 PDB entry)
  8. 150637Domain d1aua_1: 1aua 4-96 [16290]
    Other proteins in same PDB: d1aua_2

Details for d1aua_1

PDB Entry: 1aua (more details), 2.5 Å

PDB Description: phosphatidylinositol transfer protein sec14p from saccharomyces cerevisiae

SCOP Domain Sequences for d1aua_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aua_1 a.5.3.1 (4-96) N-terminal domain of phosphatidylinositol transfer protein sec14p {Baker's yeast (Saccharomyces cerevisiae)}
qqekeflesypqncppdalpgtpgnldsaqekalaelrklledagfierlddstllrflr
arkfdvqlakemfencekwrkdygtdtilqdfh

SCOP Domain Coordinates for d1aua_1:

Click to download the PDB-style file with coordinates for d1aua_1.
(The format of our PDB-style files is described here.)

Timeline for d1aua_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aua_2