Lineage for d2au7a_ (2au7 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2400325Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2400326Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2400327Protein Inorganic pyrophosphatase [50326] (9 species)
    eukaryotic enzyme has additional secondary structures at both N- and C-termini
  7. 2400367Species Escherichia coli [TaxId:562] [50329] (19 PDB entries)
  8. 2400368Domain d2au7a_: 2au7 A: [162898]
    automated match to d1i40a_
    complexed with cl, mn, na, po4

Details for d2au7a_

PDB Entry: 2au7 (more details), 1.05 Å

PDB Description: the r43q active site variant of e.coli inorganic pyrophosphatase
PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d2au7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2au7a_ b.40.5.1 (A:) Inorganic pyrophosphatase {Escherichia coli [TaxId: 562]}
sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdqfmstamfypcnygyinh
tlsldgdpvdvlvptpyplqpgsvtrcrpvgvlkmtdeagedaklvavphsklskeydhi
kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk

SCOPe Domain Coordinates for d2au7a_:

Click to download the PDB-style file with coordinates for d2au7a_.
(The format of our PDB-style files is described here.)

Timeline for d2au7a_: