SCOPe 2.05: Domain d2atma_: 2atm A:

Lineage for d2atma_ (2atm A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (72 species)
   not a true protein

7. Species Vespula vulgaris [TaxId:7454] [187426] (1 PDB entry)

8. Domain d2atma_: 2atm A: [162896]
   automated match to d1fcua_
   complexed with mes, so4

Details for d2atma_

PDB Entry: 2atm, 2 Å

PDB Description: crystal structure of the recombinant allergen ves v 2

PDB Compounds: (A:) Hyaluronoglucosaminidase

SCOPe Domain Sequences for d2atma_:

Sequence; same for both SEQRES and ATOM records:

>d2atma_ c.1.8.0 (A:) automated matches {Vespula vulgaris [TaxId: 7454]}
rvfniywnvptfmchqydlyfdevtnfnikrnskddfqgdkiaifydpgefpallslkdg
kykkrnggvpqegnitihlqkfienldkiypnrnfsgigvidferwrpifrqnwgnmkih
knfsidlvrnehptwnkkmieleaskrfekyarffmeetlklakktrkqadwgyygypyc
fnmspnnlvpecdvtamhendkmswlfnnqnvllpsvyvrqeltpdqriglvqgrvkeav
risnnlkhspkvlsywwyvyqdetntfltetdvkktfqeivinggdgiiiwgsssdvnsl
skckrlqdylltvlgpiainvtea

Timeline for d2atma_:

• d2atma_ first appeared in SCOPe 2.01
  
• d2atma_ appears in SCOPe 2.04
  
• d2atma_ appears in SCOPe 2.06
  
• d2atma_ appears in the current release, SCOPe 2.08