Lineage for d2atma_ (2atm A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2833317Species Vespula vulgaris [TaxId:7454] [187426] (1 PDB entry)
  8. 2833318Domain d2atma_: 2atm A: [162896]
    automated match to d1fcua_
    complexed with mes, so4

Details for d2atma_

PDB Entry: 2atm (more details), 2 Å

PDB Description: crystal structure of the recombinant allergen ves v 2
PDB Compounds: (A:) Hyaluronoglucosaminidase

SCOPe Domain Sequences for d2atma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2atma_ c.1.8.0 (A:) automated matches {Vespula vulgaris [TaxId: 7454]}
rvfniywnvptfmchqydlyfdevtnfnikrnskddfqgdkiaifydpgefpallslkdg
kykkrnggvpqegnitihlqkfienldkiypnrnfsgigvidferwrpifrqnwgnmkih
knfsidlvrnehptwnkkmieleaskrfekyarffmeetlklakktrkqadwgyygypyc
fnmspnnlvpecdvtamhendkmswlfnnqnvllpsvyvrqeltpdqriglvqgrvkeav
risnnlkhspkvlsywwyvyqdetntfltetdvkktfqeivinggdgiiiwgsssdvnsl
skckrlqdylltvlgpiainvtea

SCOPe Domain Coordinates for d2atma_:

Click to download the PDB-style file with coordinates for d2atma_.
(The format of our PDB-style files is described here.)

Timeline for d2atma_: