Lineage for d2ashd_ (2ash D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089551Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 2089552Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 protein domains)
  6. 2089563Protein Queosine tRNA-guanine transglycosylase [51715] (3 species)
    contains zinc-binding subdomain
  7. 2089564Species Thermotoga maritima [TaxId:2336] [187422] (1 PDB entry)
  8. 2089568Domain d2ashd_: 2ash D: [162891]
    automated match to d1ozma_
    complexed with cl, edo, zn

Details for d2ashd_

PDB Entry: 2ash (more details), 1.9 Å

PDB Description: crystal structure of queuine trna-ribosyltransferase (ec 2.4.2.29) (trna-guanine (tm1561) from thermotoga maritima at 1.90 a resolution
PDB Compounds: (D:) Queuine tRNA-ribosyltransferase

SCOPe Domain Sequences for d2ashd_:

Sequence, based on SEQRES records: (download)

>d2ashd_ c.1.20.1 (D:) Queosine tRNA-guanine transglycosylase {Thermotoga maritima [TaxId: 2336]}
mefevkktfgkarlgvmklhhgavetpvfmpvgtnasvklltprdleeagaeiilsntfh
lmlkpgveiiklhrglhnfmgwkrpiltdsggfqvfslpkiriddegvvfrspidgskvf
lnpeismevqialgsdicmvfdhcpvpdadyeevkeatertyrwalrskkafktenqalf
givqggiypdlrresalqltsigfdgyaigglsigeersltlemtevtveflpedkpryf
mgggspelilelvdrgvdmfdsvfptriarhgtaltwngklnlkasynkrslepvdercg
cytcknftrsyihhlfdrgevlgqilltihninfmislmkevrrsiesgtfkelkskvve
vys

Sequence, based on observed residues (ATOM records): (download)

>d2ashd_ c.1.20.1 (D:) Queosine tRNA-guanine transglycosylase {Thermotoga maritima [TaxId: 2336]}
mefevkktfgkarlgvmklhhgavetpvfmpvgtnasvklltprdleeagaeiilsntfh
lmlkpgveiiklhrglhnfmgwkrpiltdsggfqvfslpkiriddegvvfrspidgskvf
lnpeismevqialgsdicmvfdhcpvadyeevkeatertyrwalrskkafktenqalfgi
vqggiypdlrresalqltsigfdgyaigglsigeersltlemtevtveflpedkpryfmg
ggspelilelvdrgvdmfdsvfptriarhgtaltwngklnlkasynkrslepvdercgcy
tcknftrsyihhlfdrgevlgqilltihninfmislmkevrrsiesgtfkelkskvvevy
s

SCOPe Domain Coordinates for d2ashd_:

Click to download the PDB-style file with coordinates for d2ashd_.
(The format of our PDB-style files is described here.)

Timeline for d2ashd_: