Lineage for d1dv0a_ (1dv0 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. Protein DNA repair protein Hhr23a [46936] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [46937] (9 PDB entries)
  8. Domain d1dv0a_: 1dv0 A: [16289]
    C-terminal UBA domain

Details for d1dv0a_

PDB Entry: 1dv0 (more details)

PDB Description: Refined NMR solution structure of the C-terminal UBA domain of the human homologue of RAD23A (HHR23A)
PDB Compounds: (A:) DNA repair protein hhr23a

SCOPe Domain Sequences for d1dv0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dv0a_ a.5.2.1 (A:) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]}
qekeaierlkalgfpeslviqayfaceknenlaanfllsqnfdde

SCOPe Domain Coordinates for d1dv0a_ are not available.

Timeline for d1dv0a_: