Lineage for d2arqa_ (2arq A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568351Protein automated matches [190484] (2 species)
    not a true protein
  7. 2568352Species Human (Homo sapiens) [TaxId:9606] [188559] (17 PDB entries)
  8. 2568354Domain d2arqa_: 2arq A: [162884]
    automated match to d1by7a_
    mutant

Details for d2arqa_

PDB Entry: 2arq (more details), 1.85 Å

PDB Description: Human plasminogen activator inhibitor-2.[loop (66-98) deletion mutant] complexed with peptide n-acetyl-teaaagdggvmtgr-oh
PDB Compounds: (A:) plasminogen activator inhibitor-2

SCOPe Domain Sequences for d2arqa_:

Sequence, based on SEQRES records: (download)

>d2arqa_ e.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlcvantlfalnlfkhlakasptqnlflspwsisstmamvymgsrgstedqmasvlqfne
vgaaadkihssfrslssainastgnyllesvnklfgeksasfreeyirlcqkyyssepqa
vdflecaeearkkinswvktqtkgkipnllpegsvdgdtrmvlvnavyfkgkwktpfekk
lnglfpfrvnsaqrtpvqmmylreklnigyiedlkaqilelpyagdvsmflllpdeiadv
stglelleseitydklnkwtskdkmaedevevyipqfkleehyelrsilrsmgmedafnk
granfsgmserndlflsevfhqamvdvneegteaaagtggvmtgrtghggpqfvadhpfl
flimhkitncilffgrfssp

Sequence, based on observed residues (ATOM records): (download)

>d2arqa_ e.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlcvantlfalnlfkhlakasptqnlflspwsisstmamvymgsrgstedqmasvlqfne
dkihssfrslssainastgnyllesvnklfgeksasfreeyirlcqkyyssepqavdfle
caeearkkinswvktqtkgkipnllpegsvdgdtrmvlvnavyfkgkwktpfekkllfpf
rvnsaqrtpvqmmylreklnigyiedlkaqilelpyagdvsmflllpdadvstglelles
eitydklnkwtskdkmaedevevyipqfkleehyelrsilrsmgmedafnkgranfsgms
erndlflsevfhqamvdvneegtgrtghggpqfvadhpflflimhkitncilffgrfssp

SCOPe Domain Coordinates for d2arqa_:

Click to download the PDB-style file with coordinates for d2arqa_.
(The format of our PDB-style files is described here.)

Timeline for d2arqa_: