SCOPe 2.08: Domain d2arla1: 2arl A:6-225

Lineage for d2arla1 (2arl A:6-225)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Pocilloporin pigment Rtms5 [89866] (1 species)

7. Species Coral (Montipora efflorescens) [TaxId:105610] [89867] (3 PDB entries)

8. Domain d2arla1: 2arl A:6-225 [162883]
   Other proteins in same PDB: d2arla2
   automated match to d1mova_
   complexed with acy, cl, iod

Details for d2arla1

PDB Entry: 2arl, 2 Å

PDB Description: the 2.0 angstroms crystal structure of a pocilloporin at ph 3.5: the structural basis for the linkage between color transition and halide binding

PDB Compounds: (A:) GFP-like non-fluorescent chromoprotein

SCOPe Domain Sequences for d2arla1:

Sequence; same for both SEQRES and ATOM records:

>d2arla1 d.22.1.1 (A:6-225) Pocilloporin pigment Rtms5 {Coral (Montipora efflorescens) [TaxId: 105610]}
sviatqmtykvymsgtvnghyfevegdgkgkpyegeqtvkltvtkggplpfawdilspqc
qygsipftkypedipdyvkqsfpegftwerimnfedgavctvsndssiqgncftyhvkfs
glnfppngpvmqkktqgwepsserlfarggmlignnfmalkleggghylcefkttykakk
pvkmpgyhyvdrkldvtnhnkdytsveqceisiarkpvva

Timeline for d2arla1:

• d2arla1 first appeared in SCOPe 2.01, called d2arla_
  
• d2arla1 appears in SCOPe 2.07