SCOPe 2.08: Domain d2aqxa_: 2aqx A:

Lineage for d2aqxa_ (2aqx A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.143.1: SAICAR synthase-like [56104] (4 families)
   shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies

5. Family d.143.1.3: Inositol polyphosphate kinase (IPK) [111188] (2 proteins)
   Pfam PF03770

6. Protein automated matches [190468] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187417] (1 PDB entry)

8. Domain d2aqxa_: 2aqx A: [162876]
   automated match to d1w2fa_
   complexed with atp, mg

Details for d2aqxa_

PDB Entry: 2aqx, 2.5 Å

PDB Description: Crystal Structure of the Catalytic and CaM-Binding domains of Inositol 1,4,5-Trisphosphate 3-Kinase B

PDB Compounds: (A:) PREDICTED: inositol 1,4,5-trisphosphate 3-kinase B

SCOPe Domain Sequences for d2aqxa_:

Sequence; same for both SEQRES and ATOM records:

>d2aqxa_ d.143.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mvqwspfvmsfkkkypwiqlaghagsfkaaangrilkkhceseqrcldrlmadvlrpfvp
ayhgdvvkdgerynqmddlladfdspcvmdckmgvrtyleeeltkarkkpslrkdmyqkm
vevdpeapteeekaqravtkprymqwretisstatlgfriegikkedgsvnrdfkktktr
eqvteafreftkgnqniliayrdrlkairatleispffkchevigssllfihdkkeqakv
wmidfgkttplpegqtlqhdvpwqegnredgylsgldnlidiltemsqg

Timeline for d2aqxa_:

• d2aqxa_ first appeared in SCOPe 2.01
  
• d2aqxa_ appears in SCOPe 2.07