Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) has additional strand at N-terminus |
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) |
Species Neisseria meningitidis [TaxId:487] [187416] (6 PDB entries) |
Domain d2aqqc_: 2aqq C: [162867] automated match to d2apsa_ complexed with cu, cu1, so4, zn; mutant |
PDB Entry: 2aqq (more details), 1.65 Å
SCOPe Domain Sequences for d2aqqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aqqc_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Neisseria meningitidis [TaxId: 487]} asievkvqqldpvngnkdvgtvtitesnyglvftpdlqglseglhgfhihenpscepkee egkltaglgagghwdpkgakqhgypwqddahlgdlpaltvlhdgtatnpvlaprlkhldd vrghsimihtggdnhsdhpaplggggprmacgvik
Timeline for d2aqqc_: