SCOPe 2.01: Domain d2aqpa_: 2aqp A:

Lineage for d2aqpa_ (2aqp A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Neisseria meningitidis [TaxId:487] [187416] (6 PDB entries)

8. Domain d2aqpa_: 2aqp A: [162863]
   automated match to d2apsa_
   complexed with cu1, edo, zn; mutant

Details for d2aqpa_

PDB Entry: 2aqp, 1.3 Å

PDB Description: cu/zn superoxide dismutase from neisseria meningitidis e73a mutant

PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d2aqpa_:

Sequence; same for both SEQRES and ATOM records:

>d2aqpa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Neisseria meningitidis [TaxId: 487]}
asievkvqqldpvngnkdvgtvtitesnyglvftpdlqglsaglhgfhihenpscepkek
egkltaglgagghwdpkgakqhgypwqddahlgdlpaltvlhdgtatnpvlaprlkhldd
vrghsimihtggdnhsdhpaplggggprmacgvik

Timeline for d2aqpa_:

• d2aqpa_ is new in SCOPe 2.01-stable
  
• d2aqpa_ appears in SCOPe 2.02
  
• d2aqpa_ appears in the current release, SCOPe 2.08