| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (22 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [187415] (7 PDB entries) |
| Domain d2apxa_: 2apx A: [162856] automated match to d2aq2a1 complexed with mla |
PDB Entry: 2apx (more details), 1.8 Å
SCOPe Domain Sequences for d2apxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2apxa_ b.1.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekgdip
dgyeasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
Timeline for d2apxa_: