Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [187415] (25 PDB entries) |
Domain d2apwa_: 2apw A: [162855] automated match to d2aq2a1 complexed with mla |
PDB Entry: 2apw (more details), 2 Å
SCOPe Domain Sequences for d2apwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2apwa_ b.1.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekgdip dgyeasrpsqeqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
Timeline for d2apwa_: