Lineage for d2apva_ (2apv A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745381Species Norway rat (Rattus norvegicus) [TaxId:10116] [187415] (25 PDB entries)
  8. 2745387Domain d2apva_: 2apv A: [162854]
    automated match to d2aq2a1
    complexed with mla

Details for d2apva_

PDB Entry: 2apv (more details), 1.9 Å

PDB Description: crystal structure of the g17e/a52v/s54n/q72h/e80v/l81s/t87s/g96v variant of the murine t cell receptor v beta 8.2 domain
PDB Compounds: (A:) T cell receptor beta chain V

SCOPe Domain Sequences for d2apva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2apva_ b.1.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekgdip
dgykasrpsheqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl

SCOPe Domain Coordinates for d2apva_:

Click to download the PDB-style file with coordinates for d2apva_.
(The format of our PDB-style files is described here.)

Timeline for d2apva_: