Lineage for d2aoza_ (2aoz A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925252Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 925253Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 925258Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
  6. 925596Protein automated matches [190139] (19 species)
    not a true protein
  7. 925597Species Atropoides nummifer [TaxId:44730] [187413] (1 PDB entry)
  8. 925598Domain d2aoza_: 2aoz A: [162848]
    automated match to d1goda_
    complexed with so4

Details for d2aoza_

PDB Entry: 2aoz (more details), 2.08 Å

PDB Description: Crystal structure of the myotoxin-II from Atropoides nummifer venom
PDB Compounds: (A:) Phospholipase A2 homolog

SCOPe Domain Sequences for d2aoza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aoza_ a.133.1.2 (A:) automated matches {Atropoides nummifer [TaxId: 44730]}
nlyqlwkmilqetgknaapsygfygcncgvgsrgkpkdatdrccfvhkccykaltdcspk
tdsysyswkdktivcgknnpclkqececdkavaiclrdnldtynknykiypkplckkadd
c

SCOPe Domain Coordinates for d2aoza_:

Click to download the PDB-style file with coordinates for d2aoza_.
(The format of our PDB-style files is described here.)

Timeline for d2aoza_: