| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) ![]() |
| Family c.52.1.14: DNA mismatch repair protein MutH from [53020] (2 proteins) |
| Protein automated matches [190482] (1 species) not a true protein |
| Species Haemophilus influenzae [TaxId:727] [187414] (2 PDB entries) |
| Domain d2aoqa_: 2aoq A: [162845] automated match to d2azoa_ protein/DNA complex; complexed with ca |
PDB Entry: 2aoq (more details), 2.2 Å
SCOPe Domain Sequences for d2aoqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aoqa_ c.52.1.14 (A:) automated matches {Haemophilus influenzae [TaxId: 727]}
mipqtleqllsqaqsiagltfgeladelhipvpidlkrdkgwvgmlleralgatagskae
qdfshlgvelktlpinaegyplettfvslaplvqnsgvkwenshvrhklscvlwmpiegs
rhiplrerhigapifwkptaeqerqlkqdweelmdlivlgkldqitarigevmqlrpkga
nsravtkgigkngeiidtlplgfylrkeftaqilnaflet
Timeline for d2aoqa_: