Lineage for d2aoqa_ (2aoq A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882461Family c.52.1.14: DNA mismatch repair protein MutH from [53020] (2 proteins)
  6. 2882467Protein automated matches [190482] (1 species)
    not a true protein
  7. 2882468Species Haemophilus influenzae [TaxId:727] [187414] (2 PDB entries)
  8. 2882471Domain d2aoqa_: 2aoq A: [162845]
    automated match to d2azoa_
    protein/DNA complex; complexed with ca

Details for d2aoqa_

PDB Entry: 2aoq (more details), 2.2 Å

PDB Description: Crystal structure of MutH-unmethylated DNA complex
PDB Compounds: (A:) DNA mismatch repair protein mutH

SCOPe Domain Sequences for d2aoqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aoqa_ c.52.1.14 (A:) automated matches {Haemophilus influenzae [TaxId: 727]}
mipqtleqllsqaqsiagltfgeladelhipvpidlkrdkgwvgmlleralgatagskae
qdfshlgvelktlpinaegyplettfvslaplvqnsgvkwenshvrhklscvlwmpiegs
rhiplrerhigapifwkptaeqerqlkqdweelmdlivlgkldqitarigevmqlrpkga
nsravtkgigkngeiidtlplgfylrkeftaqilnaflet

SCOPe Domain Coordinates for d2aoqa_:

Click to download the PDB-style file with coordinates for d2aoqa_.
(The format of our PDB-style files is described here.)

Timeline for d2aoqa_: