SCOPe 2.01: Domain d2anya_: 2any A:

Lineage for d2anya_ (2any A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein automated matches [190044] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187233] (110 PDB entries)

8. Domain d2anya_: 2any A: [162844]
   automated match to d1xx9a_
   complexed with bam, po4

Details for d2anya_

PDB Entry: 2any, 1.4 Å

PDB Description: expression, crystallization and the three-dimensional structure of the catalytic domain of human plasma kallikrein: implications for structure-based design of protease inhibitors

PDB Compounds: (A:) plasma kallikrein, light chain

SCOPe Domain Sequences for d2anya_:

Sequence; same for both SEQRES and ATOM records:

>d2anya_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggtesswgewpwqvslqvkltaqrhlcggslighqwvltaahcfdglplqdvwriysg
ilelsditkdtpfsqikeiiihqnykvsegnhdialiklqapleytefqkpislpskgdt
stiytncwvtgwgfskekgeiqnilqkvniplvtneecqkryqdykitqrmvcagykegg
kdackgdsggplvckhngmwrlvgitswgegcarreqpgvytkvaeymdwilektqss

Timeline for d2anya_:

• d2anya_ is new in SCOPe 2.01-stable
  
• d2anya_ appears in SCOPe 2.02
  
• d2anya_ appears in the current release, SCOPe 2.08