Lineage for d2an0a_ (2an0 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1941879Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1941880Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 1941881Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 1942574Protein automated matches [190421] (5 species)
    not a true protein
  7. 1942575Species Bacillus subtilis [TaxId:1423] [187412] (3 PDB entries)
  8. 1942578Domain d2an0a_: 2an0 A: [162841]
    automated match to d1m7va_
    complexed with hem; mutant

Details for d2an0a_

PDB Entry: 2an0 (more details), 2.6 Å

PDB Description: crystal structure of the p332g mutant of the bacillus subtilis nos
PDB Compounds: (A:) nitric oxide synthase

SCOPe Domain Sequences for d2an0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2an0a_ d.174.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
gshaailwneakafiaecyaelgkaeevadrldsikseidrtgsyvhtkeelehgakmaw
rnsnrcigrlfwnslnvidrrdvrtkedvrdalfhhietatnngkirpsitifppeekge
kqveiwnhqliryagyegeaigdpasrsltaaceqlgwrgertdfdllplifrmrgdeqp
vwyelprslvievpithpdieafsdlelkwygvpiisdmklevggihynaapfngwymgt
eigarnladekrydklkkvasvigistnyntdlwkdqalvelnkavlysykkqgvsivdh
htaasqfkrfeeqeeeagrkltgdwtwlippisgaathifhrsydnsivkpnyfyqdkpy
e

SCOPe Domain Coordinates for d2an0a_:

Click to download the PDB-style file with coordinates for d2an0a_.
(The format of our PDB-style files is described here.)

Timeline for d2an0a_: