Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily) unusual fold |
Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) automatically mapped to Pfam PF02898 |
Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins) |
Protein automated matches [190421] (5 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [187412] (3 PDB entries) |
Domain d2an0a_: 2an0 A: [162841] automated match to d1m7va_ complexed with hem; mutant |
PDB Entry: 2an0 (more details), 2.6 Å
SCOPe Domain Sequences for d2an0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2an0a_ d.174.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} gshaailwneakafiaecyaelgkaeevadrldsikseidrtgsyvhtkeelehgakmaw rnsnrcigrlfwnslnvidrrdvrtkedvrdalfhhietatnngkirpsitifppeekge kqveiwnhqliryagyegeaigdpasrsltaaceqlgwrgertdfdllplifrmrgdeqp vwyelprslvievpithpdieafsdlelkwygvpiisdmklevggihynaapfngwymgt eigarnladekrydklkkvasvigistnyntdlwkdqalvelnkavlysykkqgvsivdh htaasqfkrfeeqeeeagrkltgdwtwlippisgaathifhrsydnsivkpnyfyqdkpy e
Timeline for d2an0a_: