Lineage for d2amua1 (2amu A:1-131)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764803Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) (S)
  5. 2764871Family b.1.13.0: automated matches [191383] (1 protein)
    not a true family
  6. 2764872Protein automated matches [190481] (2 species)
    not a true protein
  7. 2764894Species Thermotoga maritima [TaxId:2336] [187409] (2 PDB entries)
  8. 2764896Domain d2amua1: 2amu A:1-131 [162840]
    Other proteins in same PDB: d2amua2
    automated match to d1do6a_
    complexed with fe

Details for d2amua1

PDB Entry: 2amu (more details), 2 Å

PDB Description: crystal structure of a putative superoxide reductase (tm0658) from thermotoga maritima at 2.00 a resolution
PDB Compounds: (A:) Putative superoxide reductase

SCOPe Domain Sequences for d2amua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2amua1 b.1.13.0 (A:1-131) automated matches {Thermotoga maritima [TaxId: 2336]}
mklsdfiktedfkkekhvpvieapekvkkdekvqivvtvgkeiphpnttehhirwikvff
qpdgdpyvyevgryefnahgesvqgpnigavyteptvttvvklnrsgtiialsycnihgl
wessqkitvee

SCOPe Domain Coordinates for d2amua1:

Click to download the PDB-style file with coordinates for d2amua1.
(The format of our PDB-style files is described here.)

Timeline for d2amua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2amua2