Lineage for d2amtc_ (2amt C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1032069Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1032559Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 1032560Family d.79.5.1: IpsF-like [69766] (3 proteins)
  6. 1032561Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)
  7. 1032574Species Escherichia coli [TaxId:562] [69768] (12 PDB entries)
    Uniprot P62617 ! Uniprot P36663
  8. 1032592Domain d2amtc_: 2amt C: [162836]
    automated match to d1h48c_
    complexed with 1aa, gpp, zn

Details for d2amtc_

PDB Entry: 2amt (more details), 2.3 Å

PDB Description: Structure of 2C-Methyl-D-Erythritol 2,4-Clycodiphosphate Synthase complexed with a CDP derived fluorescent inhibitor
PDB Compounds: (C:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d2amtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2amtc_ d.79.5.1 (C:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli [TaxId: 562]}
mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
gchmddvnvkattteklgftgrgegiaceavallik

SCOPe Domain Coordinates for d2amtc_:

Click to download the PDB-style file with coordinates for d2amtc_.
(The format of our PDB-style files is described here.)

Timeline for d2amtc_: