SCOPe 2.05: Domain d2amob_: 2amo B:

Lineage for d2amob_ (2amo B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Bacillus subtilis [TaxId:1423] [82822] (5 PDB entries)

8. Domain d2amob_: 2amo B: [162831]
   automated match to d1m7va_
   complexed with hem

Details for d2amob_

PDB Entry: 2amo, 2.6 Å

PDB Description: Loose Dimer of a Bacillus subtilis Nitric Oxide Synthase

PDB Compounds: (B:) Nitric oxide synthase oxygenase

SCOPe Domain Sequences for d2amob_:

Sequence; same for both SEQRES and ATOM records:

>d2amob_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Bacillus subtilis [TaxId: 1423]}
shaailwneakafiaecyaelgkaeevadrldsikseidltgsyvhtkeelehgakmawr
nsnrcigrlfwnslnvidrrdvrtkedvrdalfhhietatnngkirpsitifppeekgek
qveiwnhqliryagyeaageaigdpascsltaaceqlgwrgertdfdllplifrmkgdeq
pvwyelprslvievpithpdieafsdlelkwygvpiisdmklevggihynaapfngwymg
teigarnladekrydklkkvasvigistnyntdlwkdqalvelnkavlysykkqgvsivd
hhtaasqfkrfeeqeeeagrkltgdwtwlippispaathifhrsydnsivkpnyfyqdkp
ye

Timeline for d2amob_:

• d2amob_ first appeared in SCOPe 2.01
  
• d2amob_ appears in SCOPe 2.04
  
• d2amob_ appears in SCOPe 2.06
  
• d2amob_ appears in the current release, SCOPe 2.08