Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily) unusual fold |
Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) automatically mapped to Pfam PF02898 |
Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins) |
Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species) |
Species Bacillus subtilis [TaxId:1423] [82822] (5 PDB entries) |
Domain d2amob_: 2amo B: [162831] automated match to d1m7va_ complexed with hem |
PDB Entry: 2amo (more details), 2.6 Å
SCOPe Domain Sequences for d2amob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2amob_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Bacillus subtilis [TaxId: 1423]} shaailwneakafiaecyaelgkaeevadrldsikseidltgsyvhtkeelehgakmawr nsnrcigrlfwnslnvidrrdvrtkedvrdalfhhietatnngkirpsitifppeekgek qveiwnhqliryagyeaageaigdpascsltaaceqlgwrgertdfdllplifrmkgdeq pvwyelprslvievpithpdieafsdlelkwygvpiisdmklevggihynaapfngwymg teigarnladekrydklkkvasvigistnyntdlwkdqalvelnkavlysykkqgvsivd hhtaasqfkrfeeqeeeagrkltgdwtwlippispaathifhrsydnsivkpnyfyqdkp ye
Timeline for d2amob_: