SCOPe 2.07: Domain d2amdb1: 2amd B:1-302

Lineage for d2amdb1 (2amd B:1-302)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (21 species)
   not a true protein

7. Species SARS coronavirus [TaxId:227859] [187411] (13 PDB entries)

8. Domain d2amdb1: 2amd B:1-302 [162829]
   Other proteins in same PDB: d2amda2, d2amdb2
   automated match to d1uj1b_
   complexed with 9in

Details for d2amdb1

PDB Entry: 2amd, 1.85 Å

PDB Description: Crystal Structure Of SARS_CoV Mpro in Complex with an Inhibitor N9

PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d2amdb1:

Sequence; same for both SEQRES and ATOM records:

>d2amdb1 b.47.1.4 (B:1-302) automated matches {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sg

Timeline for d2amdb1:

• d2amdb1 first appeared in SCOPe 2.01, called d2amdb_
  
• d2amdb1 appears in SCOPe 2.06
  
• d2amdb1 appears in the current release, SCOPe 2.08