Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein automated matches [190384] (21 species) not a true protein |
Species SARS coronavirus [TaxId:227859] [187411] (13 PDB entries) |
Domain d2amdb1: 2amd B:1-302 [162829] Other proteins in same PDB: d2amda2, d2amdb2 automated match to d1uj1b_ complexed with 9in |
PDB Entry: 2amd (more details), 1.85 Å
SCOPe Domain Sequences for d2amdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2amdb1 b.47.1.4 (B:1-302) automated matches {SARS coronavirus [TaxId: 227859]} sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc sg
Timeline for d2amdb1: