Lineage for d2amda_ (2amd A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1795288Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)
  6. 1795471Protein automated matches [190384] (12 species)
    not a true protein
  7. 1795528Species SARS coronavirus [TaxId:227859] [187411] (12 PDB entries)
  8. 1795529Domain d2amda_: 2amd A: [162828]
    automated match to d1uj1b_
    complexed with 9in

Details for d2amda_

PDB Entry: 2amd (more details), 1.85 Å

PDB Description: Crystal Structure Of SARS_CoV Mpro in Complex with an Inhibitor N9
PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d2amda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2amda_ b.47.1.4 (A:) automated matches {SARS coronavirus [TaxId: 227859]}
plgssgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyed
llirksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvla
cyngspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtd
legkfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamk
ynyepltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdv
vrqcsgvtf

SCOPe Domain Coordinates for d2amda_:

Click to download the PDB-style file with coordinates for d2amda_.
(The format of our PDB-style files is described here.)

Timeline for d2amda_: