![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins) |
![]() | Protein automated matches [190384] (11 species) not a true protein |
![]() | Species SARS coronavirus [TaxId:227859] [187411] (12 PDB entries) |
![]() | Domain d2amda_: 2amd A: [162828] automated match to d1uj1b_ complexed with 9in |
PDB Entry: 2amd (more details), 1.85 Å
SCOPe Domain Sequences for d2amda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2amda_ b.47.1.4 (A:) automated matches {SARS coronavirus [TaxId: 227859]} plgssgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyed llirksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvla cyngspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtd legkfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamk ynyepltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdv vrqcsgvtf
Timeline for d2amda_: