SCOPe 2.02: Domain d2amda_: 2amd A:

Lineage for d2amda_ (2amd A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)

6. Protein automated matches [190384] (12 species)
   not a true protein

7. Species SARS coronavirus [TaxId:227859] [187411] (12 PDB entries)

8. Domain d2amda_: 2amd A: [162828]
   automated match to d1uj1b_
   complexed with 9in

Details for d2amda_

PDB Entry: 2amd, 1.85 Å

PDB Description: Crystal Structure Of SARS_CoV Mpro in Complex with an Inhibitor N9

PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d2amda_:

Sequence; same for both SEQRES and ATOM records:

>d2amda_ b.47.1.4 (A:) automated matches {SARS coronavirus [TaxId: 227859]}
plgssgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyed
llirksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvla
cyngspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtd
legkfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamk
ynyepltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdv
vrqcsgvtf

Timeline for d2amda_:

• d2amda_ first appeared in SCOPe 2.01
  
• d2amda_ appears in SCOPe 2.03
  
• d2amda_ appears in the current release, SCOPe 2.08, called d2amda1