SCOPe 2.08: Domain d2amda1: 2amd A:1-305

Lineage for d2amda1 (2amd A:1-305)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (21 species)
   not a true protein

7. Species SARS coronavirus [TaxId:227859] [187411] (13 PDB entries)

8. Domain d2amda1: 2amd A:1-305 [162828]
   Other proteins in same PDB: d2amda2, d2amdb2
   automated match to d1uj1b_
   complexed with 9in

Details for d2amda1

PDB Entry: 2amd, 1.85 Å

PDB Description: Crystal Structure Of SARS_CoV Mpro in Complex with an Inhibitor N9

PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d2amda1:

Sequence; same for both SEQRES and ATOM records:

>d2amda1 b.47.1.4 (A:1-305) automated matches {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sgvtf

Timeline for d2amda1:

• d2amda1 first appeared in SCOPe 2.01, called d2amda_
  
• d2amda1 appears in SCOPe 2.07