SCOPe 2.06: Domain d2algb_: 2alg B:

Lineage for d2algb_ (2alg B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins)

6. Protein automated matches [190480] (3 species)
   not a true protein

7. Species Prunus persica [TaxId:3760] [187408] (2 PDB entries)

8. Domain d2algb_: 2alg B: [162827]
   automated match to d1afha_
   complexed with dao, hp6, p6g, so4

Details for d2algb_

PDB Entry: 2alg, 2.3 Å

PDB Description: Crystal structure of peach Pru p3, the prototypic member of the family of plant non-specific lipid transfer protein pan-allergens

PDB Compounds: (B:) non-specific lipid transfer protein

SCOPe Domain Sequences for d2algb_:

Sequence; same for both SEQRES and ATOM records:

>d2algb_ a.52.1.1 (B:) automated matches {Prunus persica [TaxId: 3760]}
mitcgqvssslapcipyvrgggavppaccngirnvnnlarttpdrqaacnclkqlsasvp
gvnpnnaaalpgkcgvsipykisastncatvk

Timeline for d2algb_:

• d2algb_ first appeared in SCOPe 2.01
  
• d2algb_ appears in SCOPe 2.05
  
• d2algb_ appears in SCOPe 2.07
  
• d2algb_ appears in the current release, SCOPe 2.08