Lineage for d2algb_ (2alg B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714860Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2714861Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2714862Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins)
  6. 2714907Protein automated matches [190480] (4 species)
    not a true protein
  7. 2714911Species Prunus persica [TaxId:3760] [187408] (2 PDB entries)
  8. 2714913Domain d2algb_: 2alg B: [162827]
    automated match to d1afha_
    complexed with dao, hp6, p6g, so4

Details for d2algb_

PDB Entry: 2alg (more details), 2.3 Å

PDB Description: Crystal structure of peach Pru p3, the prototypic member of the family of plant non-specific lipid transfer protein pan-allergens
PDB Compounds: (B:) non-specific lipid transfer protein

SCOPe Domain Sequences for d2algb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2algb_ a.52.1.1 (B:) automated matches {Prunus persica [TaxId: 3760]}
mitcgqvssslapcipyvrgggavppaccngirnvnnlarttpdrqaacnclkqlsasvp
gvnpnnaaalpgkcgvsipykisastncatvk

SCOPe Domain Coordinates for d2algb_:

Click to download the PDB-style file with coordinates for d2algb_.
(The format of our PDB-style files is described here.)

Timeline for d2algb_: