Class a: All alpha proteins [46456] (289 folds) |
Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) can be classified as disulfide-rich |
Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins) |
Protein automated matches [190480] (3 species) not a true protein |
Species Prunus persica [TaxId:3760] [187408] (2 PDB entries) |
Domain d2alga_: 2alg A: [162826] automated match to d1afha_ complexed with dao, hp6, p6g, so4 |
PDB Entry: 2alg (more details), 2.3 Å
SCOPe Domain Sequences for d2alga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2alga_ a.52.1.1 (A:) automated matches {Prunus persica [TaxId: 3760]} mitcgqvssslapcipyvrgggavppaccngirnvnnlarttpdrqaacnclkqlsasvp gvnpnnaaalpgkcgvsipykisastncatvk
Timeline for d2alga_: