SCOPe 2.01: Domain d2ak5b_: 2ak5 B:

Lineage for d2ak5b_ (2ak5 B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (5 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187407] (5 PDB entries)

8. Domain d2ak5b_: 2ak5 B: [162825]
   automated match to d1ujya_

Details for d2ak5b_

PDB Entry: 2ak5, 1.85 Å

PDB Description: beta PIX-SH3 complexed with a Cbl-b peptide

PDB Compounds: (B:) Rho guanine nucleotide exchange factor 7

SCOPe Domain Sequences for d2ak5b_:

Sequence; same for both SEQRES and ATOM records:

>d2ak5b_ b.34.2.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gsansqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvre
ikps

Timeline for d2ak5b_:

• d2ak5b_ is new in SCOPe 2.01-stable
  
• d2ak5b_ appears in SCOPe 2.02
  
• d2ak5b_ appears in the current release, SCOPe 2.08, called d2ak5b1