![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein automated matches [190043] (8 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [187407] (7 PDB entries) |
![]() | Domain d2ak5b1: 2ak5 B:5-66 [162825] Other proteins in same PDB: d2ak5b2 automated match to d1ujya_ |
PDB Entry: 2ak5 (more details), 1.85 Å
SCOPe Domain Sequences for d2ak5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ak5b1 b.34.2.1 (B:5-66) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} ansqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvreik ps
Timeline for d2ak5b1: