Lineage for d2ajpb1 (2ajp B:6-312)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137653Family c.72.1.5: PfkB-like kinase [82515] (3 protein domains)
    includes a variety of carbohydrate and pyrimidine kinases
  6. 2137682Protein automated matches [190479] (3 species)
    not a true protein
  7. 2137683Species Human (Homo sapiens) [TaxId:9606] [187406] (10 PDB entries)
  8. 2137701Domain d2ajpb1: 2ajp B:6-312 [162823]
    Other proteins in same PDB: d2ajpa2, d2ajpb2
    automated match to d1lhpa_
    complexed with anp, mg, unx

Details for d2ajpb1

PDB Entry: 2ajp (more details), 2.5 Å

PDB Description: crystal structure of a human pyridoxal kinase
PDB Compounds: (B:) Pyridoxal kinase

SCOPe Domain Sequences for d2ajpb1:

Sequence, based on SEQRES records: (download)

>d2ajpb1 c.72.1.5 (B:6-312) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvlsiqshvirgyvgnraatfplqvlgfeidavnsvqfsnhtgyahwkgqvlnsdelqel
yeglrlnnmnkydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvlgdkwdgegs
myvpedllpvykekvvpladiitpnqfeaellsgrkihsqeealrvmdmlhsmgpdtvvi
tssdlpspqgsnylivlgsqrrrnpagsvvmerirmdirkvdavfvgtgdlfaamllawt
hkhpnnlkvacektvstlhhvlqrtiqcakaqagegvrpspmqlelrmvqskrdiedpei
vvqatvl

Sequence, based on observed residues (ATOM records): (download)

>d2ajpb1 c.72.1.5 (B:6-312) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvlsiqshvirgyvgnraatfplqvlgfeidavnsvqfsnhtgyahwkgqvlnsdelqel
yeglrlnnmnkydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvlgdkwdgegs
myvpedllpvykekvvpladiitpnqfeaellsgrkihsqeealrvmdmlhsmgpdtvvi
tssdlpspqgsnylivlgsqrrrnpagsvvmerirmdirkvdavfvgtgdlfaamllawt
hkhpnnlkvacektvstlhhvlqrtiqcakaqspmqlelrmvqskrdiedpeivvqatvl

SCOPe Domain Coordinates for d2ajpb1:

Click to download the PDB-style file with coordinates for d2ajpb1.
(The format of our PDB-style files is described here.)

Timeline for d2ajpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ajpb2