Lineage for d2aiua_ (2aiu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691317Protein automated matches [190113] (17 species)
    not a true protein
  7. 2691338Species Mouse (Mus musculus) [TaxId:10090] [187404] (1 PDB entry)
  8. 2691339Domain d2aiua_: 2aiu A: [162821]
    automated match to d1akka_
    complexed with hem, po4

Details for d2aiua_

PDB Entry: 2aiu (more details), 1.6 Å

PDB Description: Crystal Structure of Mouse Testicular Cytochrome C at 1.6 Angstrom
PDB Compounds: (A:) Cytochrome c, testis-specific

SCOPe Domain Sequences for d2aiua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aiua_ a.3.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gdaeagkkifvqkcaqchtvekggkhktgpnlwglfgrktgqapgfsytdanknkgviws
eetlmeylenpkkyipgtkmifagikkkseredlikylkqatss

SCOPe Domain Coordinates for d2aiua_:

Click to download the PDB-style file with coordinates for d2aiua_.
(The format of our PDB-style files is described here.)

Timeline for d2aiua_: