Lineage for d2aiqa_ (2aiq A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1318445Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1319957Protein automated matches [190044] (14 species)
    not a true protein
  7. 1319958Species Agkistrodon contortrix [TaxId:8713] [187405] (2 PDB entries)
  8. 1319959Domain d2aiqa_: 2aiq A: [162820]
    automated match to d1op2a_
    complexed with act, ben, cl, gol, nag, ndg, so4

Details for d2aiqa_

PDB Entry: 2aiq (more details), 1.54 Å

PDB Description: crystal structure of benzamidine-inhibited protein c activator from the venom of copperhead snake agkistrodon contortrix contortrix
PDB Compounds: (A:) Protein C activator

SCOPe Domain Sequences for d2aiqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aiqa_ b.47.1.2 (A:) automated matches {Agkistrodon contortrix [TaxId: 8713]}
viggdecninehrflalvyangslcggtlinqewvltarhcdrgnmriylgmhnlkvlnk
dalrrfpkekyfclntrndtiwdkdimlirlnrpvrnsahiaplslpsnppsvgsvcrim
gwgtitspnatlpdvphcaninildyavcqaaykglaattlcagileggkdtckgdsggp
licngqfqgilsvggnpcaqprkpgiytkvfdytdwiqsiisgntdatcpp

SCOPe Domain Coordinates for d2aiqa_:

Click to download the PDB-style file with coordinates for d2aiqa_.
(The format of our PDB-style files is described here.)

Timeline for d2aiqa_: